Summa inşaat Ruanda yurtdışı iş ilanları

Yorum (106) İnşaat sektörü, Teknikerlik, Yurtdışı iş ilanları - Summa inşaat Ruanda yurtdışı iş ilanları

Uluslararası taahhüt ve gayrimenkul yatırımcılığı alanlarında faaliyet gösteren firmamızın, Ruanda’daki projemizde görevlendirilmek üzere Mimari Teknik Ressam arayışımız bulunmaktadır.
Genel Niteliklerindir (3)
Summa A.Ş. 1989 yılından beri uluslararası inşaat müteahhitliği, mühendislik, yatırım, ticaret ve müşavirlik faaliyetleri yapan; müşteri memnuniyetinin ve insan kaynaklarına yapılan yatırımın bilincinde, uluslararası standartlar doğrultusunda, çağdaş, kaliteli yönetim yaklaşımını benimseyen, sistemli, yeniliklere açık bir şekilde çalışan uluslararası bir firmadır.
Mimari Teknik Ressam (Ruanda)
Meslek Yüksek Okulların ilgili bölümlerinden mezun
En az 5 yıl deneyimli
Tercihen üst yapı ve ince işler konularında deneyimli
İyi derecede Autocad kullanabilen
İleri derecede İngilizce bilen
Takipçi, dinamik, yoğun iş temposuna uyum sağlayabilecek
Pozisyon Hakkındaki Diğer Bilgiler
Şehir/Ülke: Ruanda Cumhuriyeti
Personel sayısı: 2
Firma Sektörü: İnşaat
Pozisyon Tipi: Sürekli / Tam zamanlı
İş Alanı: Teknikerlik
Pozisyon Seviyesi: Uzman
Aday Bilgileri
Tecrübe: En az 5 yıl tecrübe
Eğitim Seviyesi: Meslek yüksekokulu (Mezun)



eleman alımı, eleman araya şirket, eleman iş başvurusu, iş başvuru formu, kariyer.net, yeni bir iş, iş başvuru şartları, iş başvuru nasıl yapılır, iş ilanı, yurtdışı işçi alımı, yurtdışı iş, yurtdışı projesi, iş ilanları 2018, insan kaynakları
Summa inşaat Ruanda yurtdışı iş ilanları yazısına yapılan yorumlar
  1. cevdet altintas dedi ki:

    Ince islerde takipci olarak calistim yurt disi tecrubem vardir arti mermer mekanik kaplama ustasi ölcu ebatlamadaiyiyi 05364984299

  2. selim tülü ------- t lfn----0553--5361--022-- dedi ki:

    selim tülü–tlfn–no–0553-5361-022—merhaba –mesleğim–mekanik makina bakım onarım arıza metal imalat ve montaj- ayrıca çelik konstrüksiyon imalatı ve montajçısıyım elektrik ark kaynağı ve gazaltı kaynakçısı ustasıyım–20–yıldan bu yana mesleğimle ilgili çalışmaktayım yurt içi yurtdışı fabrikka ve şantiye çalışmışlık deneyimlerim var bu vesile ile bünyenizde yurtdışında çalışmak istiyorum–kısaca çalışmış olduğum firmalar şunlar–samsunda kurulu olan yeşilyurt demirçelik üretim fabrikkasında kurulumundan ve montajından itibaren–13-yıl ekip başı olarak çalıştım ayrılma nedenim parasal–daha sonra–atilla makina–azerbeycanda sumgayıt bölgesinde çelik boru fabrikkası ayrıca aynı bölgede temiz içme suyu arıtma teğsizlerinde her iki projede ekip başı olarak-4-yıl çalıştım ayrılma nedenim iş bitimi—daha sonra–nurol holding aş–cezayirde algeria bölgesinde yine cezayirde annaba bölgesinde tarıma dayalı çift gövdeli büyük sulama barajı ve otoyol her iki projelerde–3–yıl ekip başı olarak çalıştım –ayrılma nedenim iş bitimi–yurtdışından yeni geldim pasaportum var mevcut– not– bu yazım sadece yurtdışı için geçerlidir istenildiğinde referans verebilirim çalışmış olduğum firmalardan referans için müdürlerimin veya şeflerimin isimlerini ve telefon numaralarını verebilirim hiç bir sakıncası yoktur seyhat engelim yok sürücü belgem var–b–sınıfı–aktif olarak araç kullanıyorum–mesleğimle ilgili test için her zaman hazırım saygılarımla—-selim tülü–tlfn–no—0553-5361-022–

  3. yaşar bukan dedi ki:

    mer 25 yıyllık aşcıyım ırak ve rusya vede afrika gibi bazı yerlerde çalıştım her türlü yemek ve şantiye ve yurt dışı ter cübem vardır yurt dışı iş arıyorum tl 05419245859

  4. ibrahim tokgöz demircelik fabrikasında gübre fb eti bakir işletmesinde calıştım kaynak montaj ustasiyim cp nr 05439046195 dedi ki:

    kaynakcı

  5. ahmet kaya dedi ki:

    selam ben elazda oturuyorum

  6. mehmet dogru dedi ki:

    selam ben arabistanda 5 yil calistim her yerine gitim mesleyim ciyesem hem sofordum hem montaj agir vastada kulanyordum yani isinize yararim ilgilenirseniz sevinirim 05304913136

  7. mustafa akgün dedi ki:

    Sayın summa personel departmanına ben kalıp ekipbasıyım daha önce rönesans mebe yurt dışi tecrubem vardır sizlerlede afrika bolgesindeki projelerinizde calışmak isterim saygılarımla cep 05327057883 05070288054

  8. mesut karaaslan dedi ki:

    kalebodur ustasıyıö yurt dışında calışmak istiyorum no 5393406557

  9. nuri yüce dedi ki:

    ince işler kalfasıyım ekibim var daha önce azerbaycan mapada calıştım 05320557597 saygılarımla

  10. murat dedi ki:

    1986 yılından beri mobilya ustasıyım ustalık belgem var ustalığımı artık yurt dışında göstermek istyorum bu yüzden sizlerle çalışmak istiyorum 05337695714

  11. aydın dedi ki:

    elektirik el aletleri kırıcılar punomatik su motorları vipratör şi şeler temir kesmemakinası ve inşaatta olan mekanik işleri yaparım25 yıldan tercubem var 05385985050

  12. latif gülmez dedi ki:

    25 yıllık tecrübeli bay aşçıyım. Bunun 7 yılını yurtdışında aşçıbaşı olarak çalıştım. Aşçılık sertifikam vardır. Yurtdışında çalışmaya engelim yoktur saygılarımla Gsm 05313488177

  13. ali çar dedi ki:

    selam silerle mumkunse calismak istiyorum daha once calisacaktim ama mumkun olmadi socide beni istediniz sonra iptal edildi utfen bu yazimi dikate alin benim meslek alci boya kartonpiyer ve buna ben zer ince isler mesleyi yapiyorum 17 senrlik tercubemle bana ulasa bileceyiniz numsralar +905417451538 +966553797895 bu arada kayitim vardir summada

  14. ahme aslan dedi ki:

    Mobil vinç oprt 10 yıllık yurt dışı tecrübem ve belgelerim mevcuttur tel 05418445807 . Gereğinin yapılmasını arz ederim

  15. ismail ulker dedi ki:

    Ben samsunlu sermikçiyim ruanda ya gidip çalımak isterim daha once yurtdışında çalıştım tel:05388233835 +22577318914

  16. slm ben muharrem kucuk1994 den beri yurtdisinda seramik mermer siva alvi civa isleryle ugrasmaktayim tukmenistan rusya libya ve en son ruanda kigalide 16 ay calistim tekrar ruandadada summa firnasiyla calismak isterim telefonum 05423045580 ruanda telim +2 dedi ki:

    muharrem kucuk

  17. slm ben muharrem kucuk1994 den beri yurtdisinda seramik mermer siva alvi civa isleryle ugrasmaktayim tukmenistan rusya libya ve en son ruanda kigalide 16 ay calistim tekrar ruandadada summa firnasiyla calismak isterim telefonum 05423045580 dedi ki:

    muharrrem kucuk

  18. ahmet yener dedi ki:

    ince işler kaynakcı ustasıyım senegalde hitarik taşron firmayınan gittim formen olarak çalıştım 15 kişi seçkin ekibimle summa sirmasına hizmet vere bilirim deherlendirmenizi isterim cep 0553 265 90 26 saygılarımla

  19. ahmet yener dedi ki:

    ince işler kaynakcı ustasıyım senegalde ince işler formeni olarak hit areks taşron firmayınan gittim 15 kişi seçgin elemanla summa firmasına hizmet vere bilirim cep 05532659026 saygılarımla

  20. hüseyin kürklü dedi ki:

    duvar ustasıyım. yurtdışı tecrübem vardır. ekibim mevcuttur. sizinle birlikte çalışmak isterim. 0536 378 92 58

  21. veysel tan dedi ki:

    iç ve dış sıva ve mantolama ustasıyım. yurtdışı tecrübem vardır. sizinle birlikte çalışmak isterim. 0537 384 22 41

  22. niyazi dedi ki:

    Slm.13 yıllık kaporta ustasiyim.gazalti, plastik kaynağı, oksijen kaynağı, elektrik kaynağı işleri yapmaktayım.27 yasinda, lise mezunuyum.ford yetkili teknisyen sertifikalarım var.yurtdisi işine ihtiyacım var.iyi çalışmalar dilerim saygilarimla.05464494882

  23. murat ulu dedi ki:

    daha önce tekfen eser arsel summa vb firmalarda çalıştım yurdışı iş aramaktayım demirci ustasıyım işe ihtiyacım var yardımcı olursanız sevinirm not ekipte isterseniz ekipte var kırşehirli demirci ustasıyız plan proje sıkıntısı yok 05535480114

  24. Adem koçoglu dedi ki:

    S.â ben 14yıldır mekanik tesisat ve kaynakcım daha önce katar Libya Arabistan ve Afrika ülkelerinde çalıştım yurtdışı tecrübem var ekibimle formen olarak veya tek usta olarak yurtdışı şantiyenizde çalışmak istiyorum num 0535 387 20 03

  25. Sadettin ibiş dedi ki:

    Merhaba 25yillik mesleki tecrübe sahibi yim yurtdışında projelerinde çalışmak istiyorum şef aşçı yım tecrübem mutfakgenel numaram 05384179014

  26. Yurtdışı tecrubem var alçıpan vede Mobilyacı.olarak.afrika.rusya.dominikcumhuriyeti.ve.arabistanda.calıştım. telefonun. .05375882130 dedi ki:

    Mesut.gozkara

  27. habib coskun dedi ki:

    merhaba ben habib coskun vinc oporotoruyum projenizde calısmak istiyorum 05443178049

  28. merhaba ben granit kupts bordor karo ustasiyim yurt disi tecrubem var summayla calismak istiyorum numaram 05453058664 dedi ki:

    Osman duran

  29. Anonim dedi ki:

    ismim Mirza GÜNEŞ 2013 temmuz ayında şirketinizde işbaşı yaptım. 8 ay gibi bir süre sizlerle çalıştım ve 2014 mart ayında işten ayrılmak zorunda kaldım. Hastalandığı ma dair sizlere bir rapor gönderdim 20 günlük bu raporu göz önüne alarak mağduriyetimin giderilmesi için son ayın maaşı tarafıma ödenmedi 8 aylık tazminat ve 20 günlük raporumla birlikte ödeme yapılmasını rica ediyorum. Aksi taktirde gerekli merci lere başvuracağım. Çalıştığım yerler OYALA VE MALABU gerekli ilgiyi göstereceğinizden eminim saygılar. Cep: 05379311481 ADRES: Milli egemenlik cad 9020 sokak 6/8 Manavgat /ANTALYA

  30. cengiz dedi ki:

    Alciboyaustasiyisummadalipyadasamaradaafrikacalistimsisdenhaberlerinizibekliyorum05365948005

  31. Anonim dedi ki:

    20 seneyi aşkın bi zamandır alçı boya-mineral sıva montalama işinde çalısmaktayım.
    -8 yıl AKTÜRK dikmen vadisinde
    -2 yıl ENPARK ASD.
    -2 yıl İTC ENERSJİ
    -1 yıl ERDEM KENT
    -4 yıl SERHAT YAPI KOOPATİFİNDE
    yurt dısı olarak gittiğim ülkeler…
    -AZERBAYCAN (FK MOBILYA)
    -ARABİSTAN/damman (YAPIMERKEZİ) şirketi ile yurt dısında calıstım tekrar yurt dısına cıkmak istiyorum.
    ekibim 30 kişiden olusmakta .
    gerekli görmeniz durumunda daha detaylı bilgi vermek için sizinle görüşmek isterim
    ilginize şimdiden teşekkür ederim.

    Saygılarımla.

    EROL ERKUŞ

    CEP- 05373526321

  32. yüksel doğu dedi ki:

    kalıp duvar alçı sıva boya elektirik
    mobilya montaj usta ekibimizvar
    0538 330 63 46

  33. Dursun Doğan dedi ki:

    EML mezunuyum.inşaatın her dalında 35 yillİk tecrübeli uzman elemanın.ruanda için veya yurtdışı firmanizla calismak istiyorum tlf:05078928494

  34. danbalan dedi ki:

    Kule vinç operatörü yum beş senelik deneyimim var ruanda projesi için sizinle çalışmak isterim

  35. muhammed acıüyük dedi ki:

    slm bn beton pompası operatörüyüm yurt dışı iş arıyorum mesleyimde kullanamadıgım pompa yoktur 05396841689

  36. Satılmış kayıkcı dedi ki:

    Slm 1998/ 2005 yılları arası sunmada biçok şantiyede çalıştım daha sonra başka firmalarla da çalıştım mesela nurol da çalıştım elinden biçok iş gelir asıl mesleğim çelik imalat ve montaj referansım fazıl çöl tel 05382946667

  37. omer ayaz dedi ki:

    1990 yılından buyanına ambarcı ambar memuru olarak yurdısında calıstım su an bosum ambar memuru ve ambarcı olarak ıs arıyorum tel05352910460 05446619408

  38. nezir keskın dedi ki:

    unuveriste mezunu 5 yıl tercubesı olan inşaat yuksek okul mezunuyum 05346345956

  39. Hulusi Günal dedi ki:

    Loder oparatörüyüm şuan firmanızda baştu şelalede calışıyorum malabu şantiyenizde .isterseniz sizinle calışmak isterim.05453426313

    • ekrem karahan 0534 207 5825 dedi ki:

      Merhaba 20 yıldır ahşap sektöründe gorev yapmaktayım daimi pasaport yurtdışı seyehat engelim yoktur rasia kuzey ıraq ve bolgelerinde bircok projeye imza attım mimar_ekrem@hotmail.com

  40. Yavuz Kundakçı dedi ki:

    Beton pompa operatörüyum yurt dışı faaliyetlerim var tüm belgelerim hazır tel 0507 918 7082

  41. Erdal Al dedi ki:

    On yillik yurtdisi tercubem var nasipse sizinle calismak isterim kalipci ustasiyim 05384023453

  42. Erdal Al dedi ki:

    05384023453 kalipci ustasi rizeliyim

  43. Ahmet selami öztürk dedi ki:

    20 yıllık aşçıyım döner sütlü tatlılar sulu yemeklerden alakarttan anlıyorum yurt dışında iş arıyorum cep:05324555791

  44. sercan özcan dedi ki:

    Mrb 30kişilik ekibimle sizinle çalışmak isteriz ekibimde demirci kalıpcı ve iş makinası oprt bulunmaktadır pasaportlarımız aktiftir 0541 281 43 23

  45. sercan özcan dedi ki:

    Mrb 30kişilik ekibimle sizinle çalışmak isteriz ekibimde demirci kalıpcı ve iş makinası oprt bulunmaktadır pasaportlarımız aktiftir 0541 281 43 23

  46. Anonim dedi ki:

    Sayfa 1/1HASAN ÜNLÜ Adres: Cumhuriyet Mh. M.Ali Cad. No. 9 Merkez / AFYON Cep: (537) 513 69 92 E-posta: hasanunlu72@gmail.com KİŞİSEL BİLGİLER Cinsiyet : Bay Doğum Tarihi : 01/03/1972 Medeni Durum : Evli Uyruk : T.C. Sürücü Belgesi : C Askerlik Durumu : Yapıldı. KARİYER HEDEFİ Kısa vadede, eğitim ve kariyer geçmişime uygun bir kariyer fırsatı yakalamak. Uzun vadede, şirkete tecrübelerimle değer katmak. EĞİTİM BİLGİLERİ Ortaöğretim Afyon İŞ DENEYİMİ 1998-2000 Gama A.Ş. Gaz rafinerisi saç kaplama (ÖZBEKİSTAN) 2000-2001 TEKFEN A.Ş. Gaz rafinerisi saç kaplama (ÖZBEKİSTAN) 2003-2004 RÖNESANS A.Ş. Bira fabrikası havalandırma sistemleri (UKRAYNA) 2004-2006 RÖNESANS A.Ş. Su ile tedavi merkezi havalandırma Formeni (Truskavets / UKRAYNA) 2006-2009 RÖNESANS A.Ş. Bira fabrikası havalandırma Formeni (UKRAYNA) 2009-2010 RÖNESANS A.Ş. Rovna Çimento fabrikası İnce işler Formeni (UKRAYNA) 2011-2012 RÖNESANS A.Ş. İnce işler Formeni (Gamka Taşeron) (TÜRKMENİSTAN) 2013-2015 RÖNESANS A.Ş. Trinity AVM Şantiyesi Havalandırma Formeni (St. Petersburg / RUSYA) Raduga AVM Şantiyesi Havalandırma Formeni (St. Petersburg / RUSYA) KURS / SERTİFİKA BİLGİLERİ Mekanik Tesisat BİLGİSAYAR BİLGİSİ Word, Excel ,Outlook YABANCI DİL BİLGİSİ Rusça Okuma: İyi, Yazma: İyi, Konuşma: İyi REFERANSLAR Mek. Müh. Özgür KARACA Rönesans A.Ş. Mek. Müh. İbrahim TEMİZ Rönesans A.Ş.

    Dokümanda bulun
    1/1

  47. hasan ünlü dedi ki:

    Sayfa 1/1HASAN ÜNLÜ Adres: Cumhuriyet Mh. M.Ali Cad. No. 9 Merkez / AFYON Cep: (537) 513 69 92 E-posta: hasanunlu72@gmail.com KİŞİSEL BİLGİLER Cinsiyet : Bay Doğum Tarihi : 01/03/1972 Medeni Durum : Evli Uyruk : T.C. Sürücü Belgesi : C Askerlik Durumu : Yapıldı. KARİYER HEDEFİ Kısa vadede, eğitim ve kariyer geçmişime uygun bir kariyer fırsatı yakalamak. Uzun vadede, şirkete tecrübelerimle değer katmak. EĞİTİM BİLGİLERİ Ortaöğretim Afyon İŞ DENEYİMİ 1998-2000 Gama A.Ş. Gaz rafinerisi saç kaplama (ÖZBEKİSTAN) 2000-2001 TEKFEN A.Ş. Gaz rafinerisi saç kaplama (ÖZBEKİSTAN) 2003-2004 RÖNESANS A.Ş. Bira fabrikası havalandırma sistemleri (UKRAYNA) 2004-2006 RÖNESANS A.Ş. Su ile tedavi merkezi havalandırma Formeni (Truskavets / UKRAYNA) 2006-2009 RÖNESANS A.Ş. Bira fabrikası havalandırma Formeni (UKRAYNA) 2009-2010 RÖNESANS A.Ş. Rovna Çimento fabrikası İnce işler Formeni (UKRAYNA) 2011-2012 RÖNESANS A.Ş. İnce işler Formeni (Gamka Taşeron) (TÜRKMENİSTAN) 2013-2015 RÖNESANS A.Ş. Trinity AVM Şantiyesi Havalandırma Formeni (St. Petersburg / RUSYA) Raduga AVM Şantiyesi Havalandırma Formeni (St. Petersburg / RUSYA) KURS / SERTİFİKA BİLGİLERİ Mekanik Tesisat BİLGİSAYAR BİLGİSİ Word, Excel ,Outlook YABANCI DİL BİLGİSİ Rusça Okuma: İyi, Yazma: İyi, Konuşma: İyi REFERANSLAR Mek. Müh. Özgür KARACA Rönesans A.Ş. Mek. Müh. İbrahim TEMİZ Rönesans A.Ş.

    Dokümanda bulun
    1/1

  48. ahmet birogul dedi ki:

    Kalıpçı ustasıyım usta belgesi mevcuttur 15 senelik tecrübem var bilginize 05545656181

  49. Kalipci ustasiyim 15 yıllık yurtdışı tecrübem var tlf 05413726655 dedi ki:

    Abdullah cip

  50. Sefa bülbül dedi ki:

    Mermer Granit seramik işleri yapıyorum ekibimiz var 05332315430

  51. Aykut dedi ki:

    Patronum 05327965022

  52. Aykut dedi ki:

    Ruanda dis ticaret ve faliyetleri konusunda uluslar arasi bilgi ve gorusmelere sahibim 05327965022

  53. yılmaz sahin dedi ki:

    15 yıldır yurtdışında elektrik formen ligi yaptım iş arıyorum

  54. tevfik doğucu dedi ki:

    35 yıllık seramik mermer ustasıyım yurt dışı tecrübemiz var ekip halinde çalışabiliriz

  55. Summa inşaat aş benim favorim dedi ki:

    Ben murat karayigit temelden kalıp demir işleri ayrıca her çelik kalıp peri kalıp montaj kurulum işleri yapılır tecrübeli ekip talebe göre 30kişi ile 50kişi arasında deneyimli hazır ekip mevcuttur yurtdışı ağırlıklı olmak kaydıyla

  56. merhaba demirciyim sizinlen calismak istiyorum .05362460866 dedi ki:

    Burhan

  57. Süleyman Güler dedi ki:

    Duvarcı ustasıyım yurtdışı tecrübem çok sizinle çalışmak istiyorum 05353862148

  58. Ragip dedi ki:

    Mrb ben antalyadan Ragıp kasap,döner,ızgara,çeşitleri, kebap, poğaça, açma, kol böreği, kuru pasta, yaş pasta,tatlılar gibi..v..s ustasiyim sizinle çalışmak isterim ilgilenirseniz sevinirim sonyyy_20_@hotmail.com. .05459473921

  59. süleyman dedi ki:

    Slm ben süleyman gazalti ve elektrik kaynakçısı yım yurtdışında çalışmak istiyorum imalat ve montajcisi yım ilgilenirseniz sevinirim 5438671228

  60. erkan bingol dedi ki:

    Operatorum summada calistim libya projesinde loder bopcet operatoru olarak summada calismayi istiyorum5398934259

  61. lutfi çankaya dedi ki:

    Slm ben kalıp duvar ustasiyim 30 kişilik ekibiz daha önce kazakistan basakolda ve astana alarko ve ccc arabtec firmalarında 4 yıl çalıştık sunma insaatlada çalışmak isterim tlf 05459311285

  62. mustafa dedi ki:

    Slm ben kepce oparatoruyum loder eskavator ve jcb hidromek kullanmaktayim ihtiyac olursa gitmeyi dusunuyorum saygilarimla yurtdisina gitmek istiyorum 0543 944 50 44

  63. hayrettin dedi ki:

    slm ben kalıpcı kalfasıyım ekipim var 25 yıldır yurt dışınta calışıyorum rusyatan yenı geltım cavapınızı beklerım 05355869281

  64. Mustafa kaya dedi ki:

    Mobil pompa operatörüyüm yurt dışında çalışmak istiyorum. Tel 05453578456

  65. Mustafa kaya dedi ki:

    Beton pompa operatörüyüm yurt dışında çalışmak istiyorum. Tel: 05453578456

  66. baki dedi ki:

    slm duvar kagıdı alcı boya ustasıyım ekibim var evraklar hazır 05342122217

  67. Muhammet ŞİRİNER dedi ki:

    35 inşaat ince işleri ile uğraşmaktayım. İşçilik, taşeronluk ve formenlik yaptım. Yurt dışı işçilik ve formenlik tecrübem vardır. Yurt dışında uzun süreli çalışabilirim. Sizlerle birlikte çalışmak isterim. Saygılarımla. 0 505 326 55 06 Ankara

  68. cemil alka dedi ki:

    20 yıllık yurtdışı yurt içinde elektrik ustalık ve formenlik yapmpaktayım kahire haalanında 2 ay sonra işim bitmekte sizinle çalışmaya mutluluk duyuyorum

  69. cemil alka dedi ki:

    20 yıllık yurtdışı yurt içinde elektrik ustalık ve formenlik yapmpaktayım kahire haalanında 2 ay sonra işim bitmekte sizinle çalışmaya mutluluk duyuyorum cemil.123@hotmail.com 05447124147

  70. Muhammet oduget dedi ki:

    Sihhi su tesisatciyim afrika deneyimim vardir Tanzanya da calustim 2sene ustayimdir dusunulurse gelebilirim

  71. muhammet taşpınar dedi ki:

    merhaba ben çelik montaj ve çelik imalatcı ekip başıyım,aynı zamanda profosyenel kaynakçıyım.16 yıldır bu meslekteyim,projem akıcı olup ingilizcem iyidir.daha önce katarda 2 yıl,bulgaristanda 1 yıl ve türkmenistanda 1 yıl çalıştım.sizinde yurtdışı projelerinizden birnde görev almak isteiğimi bilgilerinize arz ederim..ceptel:545 886 20 90

  72. Huseyin madenli dedi ki:

    Merhaba ben Adana’dan 23 yıllık ekskavatör oparatoruyum.yurt dışında sizlerle çalışmak isterim.oto yol.baraj.tünel vb tüm işlerde çalıştım.ehliyetim ve pasaportum mevcuttur teşekkür ederim tel 0538 865 20 58

  73. Huseyin madenli dedi ki:

    Merhaba ben Adana’dan 23 yıllık ekskavatör oparatoruyum.yurt dışında sizlerle çalışmak isterim.oto yol.baraj.tünel vb tüm işlerde çalıştım.ehliyetim ve pasaportum mevcuttur teşekkür ederim tel 05388652058

  74. nezih KAPIDAĞ dedi ki:

    1995 GAZİ ÜNİ. M Y O İNŞAAT BÖLÜMÜ MEZUNUYUM.YURT İÇİ VE YURT DIŞI TECRÜBELERİM VAR.AÇIK OLAN İŞ KOLUNUZDA GÖREV YAPABİLİRİM.
    SAYGILARIMLA.

    TEL:05337661013

  75. Gürsel dedi ki:

    Merhaba, Rusya’da , Arabistan’da , Cezayir’de, Fas’ta demirci kalfası olarak çalıştım ve ekip götürdüm iyi firmalar da çalıştım. Sizinle de yani Summa firması ile iş yapmaya çok isterim. İzmir’de oturuyorum telefon numaram 0536 732 98 41

  76. Zafer Arpa dedi ki:

    Konkasör ustalığı ve formenliği veocak formenliği yapmaktayım.05366460449

  77. Anonim dedi ki:

    Hüseyin keklik asfalt pilent opr törüyüm. 18 sene operatör olarak çalışıyorum yurt dışında çalıştım kazakiztanda alsimalarko fasta Nurol türkiyede mön inşaata çalıştım.yurt dışı işi arıyorum tlf 0553 559 1914

  78. Bilal güreşçi dedi ki:

    Selamlar 15 yillik damperli kamyon şöförüyüm devamlı baraj yol yapımlarında çalıftım şu an ist 3.hava alanında çalışıyorum
    sizinle yurtdışında çalışmak ıstiyorum tlf.0538 647 06 22

  79. Anonim dedi ki:

    Hüseyin keklik asfalt pilent operatörü tüm yurtdışı Kazakistan Cezayir Fas azerbaycan fark etmez.tlf 0553 553 19 14.

  80. hayrettin böler dedi ki:

    Merhaba ben altyapi drenaj boru montajustasiyim menfez kros istinat duvari bordörtaşi vekaskat doseme ustasiyim yurtdisi calisma engelim yok sizlerle yurtdisi işlerinde çalışmak isterim tel 0536 569 41 36

  81. BÜLENT KOZANOĞLU dedi ki:

    SELAMNIN ALEYKÜM DUVAR BOYA ALCI MONTALAMA KALFASIYIM 30 KİŞİLİK EKİBE SAHİBİM İŞLERİMİZ BİTTİGİNDEN BOŞA DUŞTUK YURT DIŞINDA CALIŞMAK İSTİYORUZ SİZLERDE UYGUN GÖRÜRSENİZ SİZNLE CALIŞMAKTAN GURUR DUYARIM SAYGILARIMLA 05462287778

  82. hayrettin koc dedi ki:

    slm kalıpcı formeniyim ekipim var 15 yıldır yurt dışınta calışıyorum sizlerlete calışmak isterim 05355869281

  83. ejder yavuz dedi ki:

    alcıpan betopan vede kaynak catı celık montaj ustası yurdısı tecrubelı pasaport 10 yıllık tel 05357265909

  84. yusuf ucar dedi ki:

    cengiz insaat.tekfen .nurol.ve icdas firmalarında prefabrik ve konteyner montaj ve demontaj su kalorifer tesisat ve yöneticilik yaptım

  85. bahittin kayabaşı dedi ki:

    inş ustasıyım kalıpcı demirci ekibim var 05464324484 sizinle calışmak istiyoruz

  86. Abdurrahman damar dedi ki:

    3 ncü hava limanında çalışmak istiyorum e+d sınıfı ehliyetim var src ler pisikoteknik mevcut tel 05423401498

  87. DUSHMIMANA ALOYS dedi ki:

    Merhaba! Ruanda’da doğdum. Ruandalıyım. Mühendisim(inşaat mühendisiliği). simdi Türikiyedeyim. yüksekesk lisans(yapı)okuyorum. samsunda Kalıyorum.beş dili biliyorum:ingilizce, fransizca,kinyarwanda, kiswahili, kirundi ve turkçe.iş varsa herhangi yere gidebilirim, herhangi şirket’te çalışabilirim . inşaat mühendisiliği ile ilgili tecrubem var. telefon numaram: +905366560436/ email: aloysdushimimana@yahoo.fr

  88. merhaba, ben manisadan orhan nergiz. Alçı boya mantolamacıyım iyi derce arapçam var firmanızda çalışmak isterdim halen 4yıllık pasaportum var, ilgileniyorsanız TEL: 0537 688 80 94 dedi ki:

    Orhannergiz@hotmail

  89. Celik montaj ustalarim ve cok saglam montajci ekibim var fas santiyenizde bu ekibimle beraber calismak istiyorum dedi ki:

    Siyami guney

  90. ahmet şirvan dedi ki:

    beton santrali operatörüyüm 10 yıl dewneyimmim var 05335687422

  91. necmeddin ülker dedi ki:

    soğuk demirciyim makineciyim yurt dışına gitmek istiyorum tel 05362742012

  92. sabribenal dedi ki:

    merhaba ben 22senedir inşaatla ugraşıyorum 9 senesini altyapı cevredüzenleme inşaat formeniolarakgörevyaptım kalıpcı duvarcı ustalıkbelgemvar e sınıfıehliyetimvar sizinle calışmak isteim tlf 05376598733

  93. Ali kırtay dedi ki:

    8 yıldır mikser kullanıyorum orta derecede Arapça biliyorum yurtdışı iş yarıyorum bana yardımcı olursanız sevinirim 0545 421 32 87

  94. Ibrahim tezcan dedi ki:

    Meraba ben ibrahim tezcan afrika tecrubem vardir fayans granit mermer seramik ustasiyim isimde pirafosyenelim eger isterseniz sizinle calismak isterim yurt disi tecrubem vardir 0534 609 6502 kayseriliyim

  95. Arif dedi ki:

    Emekliyim, Istanbul da yasıyorum, daha evvelden Enka – Baghdad yurtdışı projelerinde dıs ilişkiler yetkilisi olarak calısmıslıgım var (2 sene) ofis ve dıs işler takip cisi olarak tekrardan calısmayı dusunurum.
    Arif – 05362434181

  96. Murat özbek dedi ki:

    Merhaba ben murat ôzbek ben sizle beraberaber calişmak istiyorum biz birekip olarak calişmak istiyoruz saygılarimla mevcudumuz toplam 60 tel 05319516458

  97. Gazi aribey dedi ki:

    Santal oporotoruyum7sene77insaaterbilde6yil la farce de ce zaïrois latin instants calisson turfistes si zone ça lis mal istiyorum

  98. ERDAL GULPOLAT dedi ki:

    E VE G İS MAKİNASİ EHLİYETİM SERTİFALARİM VAR KULE VİNC MANUTOR CİSİBİ ESKAVATOR OPOROTORUYUM YURTDİSİNDA CALİSMAK İSTİYORUM İSTENİLDİGİ ZAMAN GOREV YAPMAYA HAZİRİM TELEFONUM 05368634973 NOLU TELEFONDAN BANA ULASA BİLİRSİRSİNİZ

  99. Metin can dedi ki:

    slm benim kalıpçı ekibim var 12 sene yurtdışında iş yaptım tep inşaat çalıştım kuzeırakta gürbağda çalıtım ayyapda çevikler gunede pöroje a afkanistanda iş yaptım 0537 273 57 36 sizilede işyapmak istiyourm

  100. Metin can dedi ki:

    slm benim kalıpçı ekibim var 0537 273 57 36

  101. Selam summada kongo projesinde calştım yurtdışında calışmakistiyorum marangoz alcıpancı ustayım 0539 582 2096 dedi ki:

    Kadir koc

  102. hasanböyüksarı dedi ki:

    slmkalıpcıveduvarcıvedemirciustayım05446830613

  103. hasan dedi ki:

    Is mim. Hasan. Kulevinc. Montajcisi. Ve. Mekanik. Ustasoyim. 05464939424

  104. merhaba.sizinle.calismak.istiyorum dedi ki:

    Kulevincmontajvemekanikcisiyim 05464939424

  105. adem yıldız dedi ki:

    slm ben mekanik montajcı formeni 9 yıllık rusya tecrübem var 6 yıl enka inşaat 2 yıl orimex suvar 1 yıl polimex firmaalarla çalıştım ankara loft incek akfen şantiyesi istanbul zorlu center ekin proje istanbul maltepe rolesans şantiyesi nde mekanik şantiye şefi olarak görev yaptım kaliteli düzgün sorunsuz iş yapan ekibim var summa firmasıyla çalışmak istiyorum saygılarımla 05537083231